RESEARCH

OncoGen is a research centre for Gene and Cellular Therapies in Cancer

Applicability of research results in clinical practice

The first research centre in Romania and Eastern Europe, with state-of-the-art equipment for basic and applied research in the field of gene therapies. The Centre has basic and applied research facilities, with 15 compartments including a GMP facility and laboratories endowed with high performance equipment.

PROJECTS

The main research projects developed at OncoGen

Cellular and gene therapies for cancer

Chimeric antigen receptor targeted oncoimmunotherapy with NK cells

Molecular approach to ragweed allergy diagnosis and therapy

Romania-Serbia Joint Initiative against Cancer in Cross-Border Region: Improved Diagnosis and Treatment of Malignant Tumors

BIOeconomic approach to AntiMicrobial agents – use and Resistance

BIOnotechnologies based on Extracellular Vesicles for early diagnosis, prognosis and therapy of atherosclerosis

NEWS & EVENTS

OncoGen’s research activities at a glance

Cercetătorii OncoGen au dezvoltat un vaccin alergen-specific bazat pe alergene recombinate de ambrozia

Cercetătorii OncoGen au dezvoltat un vaccin alergen-specific bazat pe alergene recombinate de ambrozia

OncoGen News
Prevalența bolilor alergice care includ rinita alergică și astmul sunt în creștere la nivel mondial, în special în țările cu...
Read More
OncoGen COVID-19 vaccine project recognized by the World Health Organization (WHO)

OncoGen COVID-19 vaccine project recognized by the World Health Organization (WHO)

OncoGen News OncoGen Researchers
The World Health Organization (WHO) recognized OncoGen, as the only research centre in Romania that has a protein subunit COVID-19...
Read More
OncoGen researchers  propose personalized vaccinomics strategy for the novel China coronavirus

OncoGen researchers propose personalized vaccinomics strategy for the novel China coronavirus

OncoGen Researchers
OncoGen researchers propose a novel approach for producing epitope-based peptide vaccine candidates for the novel China coronavirus (nCoV). Wuhan seafood...
Read More
1 2 3
Cercetătorii OncoGen au dezvoltat un vaccin alergen-specific bazat pe alergene recombinate de ambrozia

Cercetătorii OncoGen au dezvoltat un vaccin alergen-specific bazat pe alergene recombinate de ambrozia

Prevalența bolilor alergice care includ rinita alergică și astmul sunt în creștere la nivel mondial, în special în țările cu venituri mici și medii, datorită unor factori complecși care cuprind și modificările climatice, poluarea și expunerea alergenică în continuă schimbare. Conform OMS, complexitatea și severitatea bolilor alergice continuă să crească în special la copii și adulții tineri, care suferă cea mai mare povară a acestor tendințe. Unul din patru europeni este alergic. Polenul de ambrozia face parte dintre aero-alergenele care produc forme severe de rino-conjunctivită cu evoluție implacabilă spre astm sever, din perioada de vară și până toamna târziu. Problema majoră de sănătate publică legată de expunerea la polenul de ambrozia este studiată de colectivul nostru de la OncoGen de peste 15 ani, cu patru direcții clare:

1. Monitorizarea expunerii populației la alergenele din aerul atmosferic, cu accent pe monitorizarea expunerii la polenul de ambrozia – alergenul cu cel mai mare potențial sensibilizant și care induce formele cele mai severe de boală la categorii largi populaționale (de la copii la adulți și bătrâni)
2. Dezvoltarea unor kituri de diagnostic de mare precizie a sensibilizării la ambrozia, având în vedere că pe baza testelor actuale de diagnostic se pierd aproximativ 10% dintre pacienții alergici la ambrozia
3. Dezvoltarea unor kituri de măsurare a prezenței polenului de ambrozia în aerul atmosferic, având în vedere că în prezent nu există un astfel de test pe piață
4. Dezvoltarea unui vaccin alergen-specific pe baza alergenelor recombinate de ambrozia

Avantajele monitorizării expunerii populației la alergenele din aerul atmosferic le-am dovedit de peste 13 ani, pe baza primului proiect național de cercetare asupra impactului aero-alergenelor asupra stării de sănătate a populației din vestul României (PREVALERG) derulat în perioada 2007-2010. Principalul rezultat al proiectului a fost că a dovedit științific amploarea sensibilizării la ambrozia în România, responsabilă de afectarea a peste 60% din populația alergică, inclusiv a imapactului asupra vârstelor mici – inclusiv asupra copiilor în primul an de viață, ceea ce dovedește efectul sensibilizării la ambrozia încă din viața intrauterină, ca factor epigenetic. Am creat cea mai mare bază de date de pacienți alergici din România. Am asigurat prima monitorizare pe termen lung (3 ani) a concentrației polinice din aerul atmosferic și am dovedit corelația între gradul de expunere la aero-alergene și creșterea prevalenței și a severității bolilor alergice respiratorii. De peste 10 ani susțin necesitatea implementării unor sisteme de monitorizare și alertă asupra expunerii la aero-alergene la nivel local și național, care să permită cunoașterea tipului și concentrației diferitelor alergene din aerul atmosferic, precum și al perioadei de expunere a populației. Aceasta ar fi o primă măsură de prevenție și control al bolilor alergice respiratorii.
Următoarele trei direcții de cercetare le-am realizat în cadrul proiectului INSPIRED (2016-2020), primul proiect din România axat pe aplicarea tehnologiilor avansate bazate pe alergene recombinate pentru diagnosticul, tratamentul și prevenția bolilor alergice. La Timișoara, am reușit să producem pentru prima dată în România alergenele recombinate din polenul de ambrozia, le-am testat și suntem în faza de brevetare a două kituri de diagnostic molecular bazat pe alergene recombinate din polenul de ambrozia, unul de diagnostic serologic (care să crească specificitatea și sensibilitatea testării inclusiv pentru acei 10% dintre pacienții al căror diagnostic nu este posibil prin testarile actuale) și unul de măsurare a prezenței polenului de ambrozia în aerul atmosferic.
Cea mai important țintă, dezvoltarea unui vaccin bazat pe alergene recombinate din polenul de ambrozia pentru tratamentul pacienților alergici la ambrozia, a trecut de faza de cercetare-dezvoltare și este în faza de microproducție. Vaccinul pe care l-am dezvoltat este cel mai inovativ vaccin de acest gen la nivel european, deoarece conține toate fragmentele alergenice esențiale în dezvoltarea răspunsului imun. Este necesară trecerea la studii clinice, care implică costuri ridicate și timp, dar știm că alergologia moleculară este viitorul și terapia bazată pe alergene recombinate poate fi soluția pentru tratamentul bolilor alergice. Imunoterapia alergen-specifică este una dintre cele mai importante arme ale medicului alergolog în lupta cu boala, fiind considerată singura terapie care modifică evoluția bolii, reorientând răspunsul imun al pacientului spre toleranță. Avantajele acestui vaccin bazat pe tehnici moderne de biologie moleculară față de preparatele de imunoterapie alergen-specifică aflate pe piață constă în înalta sa specificitate, lipsa efectelor secundare induse de preparatele bazate pe extracte aalergenice, numărul redus de administrări, ceea ce îl va face mult mai eficient, mai bine tolerat și va crește complianța pacienților la terapie.

Toate aceste realizări au fost posibile mulțumită unui colectiv condus de Prof. Dr. Carmen Bunu-Panaitescu, cu contribuția Dr. Kuan-Wei Chen (director al proiectului INSPIRED, coordonat de centrul OncoGen) și sub îndrumarea științifică a Prof. Dr. Rudolf Valenta (Universitatea de Medicină din Viena), unul dintre cei mai reputați alergologi din lume.

OncoGen COVID-19 vaccine project recognized by the World Health Organization (WHO)

OncoGen COVID-19 vaccine project recognized by the World Health Organization (WHO)

The World Health Organization (WHO) recognized OncoGen, as the only research centre in Romania that has a protein subunit COVID-19 vaccine candidate in pre-clinical tests.

OncoGen joins reputable academic institutions and private companies known for their expertise in the field of vaccine development and high-performing biomedical research.

The full list of candidate vaccines in clinical and pre-clinical tests, as of April 4, 2020, can be found at: https://www.who.int/blueprint/priority-diseases/key-action/Novel-Coronavirus_Landscape_nCoV-4april2020.pdf

OncoGen researchers  propose personalized vaccinomics strategy for the novel China coronavirus

OncoGen researchers propose personalized vaccinomics strategy for the novel China coronavirus

OncoGen researchers propose a novel approach for producing epitope-based peptide vaccine candidates for the novel China coronavirus (nCoV).

Wuhan seafood market pneumonia virus, also known as 2019 Novel Coronavirus (2019-nCoV) is a relative of both the deadly severe acute respiratory syndrome (SARS) and the Middle East respiratory syndrome (MERS) viruses. According to Nature Briefing, by January 28, the number of confirmed cases has jumped to more than 4,500 with more than 100 people dead as a result of the infection. By comparison, SARS spread globally in 2002-03, infecting 8000 and killing more than 700 people.

Traditional vaccines for viral diseases had limited success in the case of viral epidemics with high mutation rates. The approach that we used for designing potential peptide vaccine candidates takes a more personalized strategy, referred to as vaccinomics, which enables the selection of target viral proteins with low mutation rates, and the design of peptides tuned to the immune characteristics of the target populations, variable based on geographic location and ethnicity.

Based on the human MHC (human leukocyte antigen) allele variation, the peptide vaccines can be made more relevant to a community or individual. The selection of the peptides that could act as vaccines is determined by the binding of the processed viral peptide with the major histocompatibility complex (MHC) class I and II molecules, and the relevant HLA alleles.

Our proposed candidate peptides take into consideration the most frequent HLA alleles found in the Romanian population.

Technical details of the approach used are detailed below:

We identified multiepitope peptide vaccine candidates against nCov that can potentially trigger both CD4+ and CD8+ T cell immune response. To this end, we designed 15-30 aa synthetic long peptides (SLPs), as proposed by Rabu et al. (2019), using a cathepsin-sensitive linker (LLSVGG) for linking MHC class I-restricted epitopes to MHC class II-restricted epitopes, with the MHC class II epitope located always at the N-terminal end, to stimulate both CTLs and T helper lymphocytes (together with innate immune system).

GenBank Acc. No. of coronavirus isolate Wuhan-Hu-1 used for analysis: MN908947.3 which is identical to Ref Seq NC_045512 (provisonal ref seq, under review by NCBI): https://www.ncbi.nlm.nih.gov/nuccore/NC_045512.2

It is an enveloped, positive-sense, single-stranded poly-adenylated RNA virus, with a genome of 29.9 kb (29903 bp), among the largest of all RNA virus genomes.

Complete genomic sequences known to date: S and M proteins important as target for nCoV vaccine; S = spike (for adhesion and fusion); M = membrane (for replication and virion exocytosis).

The tool from the Immune Epitope Database (IEDB) server was used to identify potent T cell epitopes from the sequences of S and M proteins. For CD8+ T cell epitopes, the prediction method integrated MHC class I binding, proteasomal cleavage and TAP transport efficiency. Several epitopes were selected for further analysis based on high overall score and if they showed high MHC binding affinity (IC50 <50 nM) (Table 1). For CD4+ T cell epitopes, the highest ranking peptide based on MHC class II binding was chosen (Table 2).
The class I and class II MHC alleles considered were the most frequent alleles in Romania, according to Constantinescu et al. (2017):

HLA-A*02 (29%)
HLA-A*01 (14.3%)
HLA-A*24 (11.2%)
HLA-B*35 (16%) (superfamily B07)
HLA-B*18 (11%) (superfamily B44)
HLA-DRB1*11 (18.5%)
HLA-DRB1*03 (11.3%)
HLA-DRB1*13 (10.5%)

Synthetic Long Peptide Vaccine candidate for S protein

GNYNYLYRLFRKSNLLSVGGYLQPRTFLL

                                                       YLQPRTFLL    HLA-A*0201 epitope

GNYNYLYRLFRKSN                                            HLA-DRB1*1101 epitope

               LYRLFRKSNLLSVG                               HLA-DRB1*1301 epitope

Synthetic Long Peptide Vaccine candidate for M protein

SYFIASFRLFARTRSLLSVGGGLMWLSYFI

                                                    GLMWLSYFI  HLA-A*0201 epitope

SYFIASFRLFARTRS                                          HLA-DRB1*1101 epitope

        ASFRLFARTRSLLS                                    HLA-DRB1*1301 epitope

Synthetic Long Peptide Vaccine candidate for S and M proteins

SYFIASFRLFARTRSLLSVGGYLQPRTFLL

                                                      YLQPRTFLL  HLA-A*0201 epitope

SYFIASFRLFARTRS                                          HLA-DRB1*1101 epitope

        ASFRLFARTRSLLS                                    HLA-DRB1*1301 epitope

 

The candidate peptides presented above were designed by applying to viral antigens a technology used for personalized vaccination in cancer, based on long neoantigen peptides, currently in clinical trials for cancer therapy.
Based on this model, additional peptide candidates can be identified for populations from different geographic regions of the world.
The current approach is a compromise between an industrial large-scale global vaccination strategy and an individually-targeted personalized vaccination strategy.
We will continue the validation of these candidates and of the model.

Image source: Eye of Science/SPL

Contact

Pius Branzeu Clinical Emergency Hospital
300723 Timisoara, Romania
156, Liviu Rebreanu Boulevard
info@oncogen.ro

© OncoGen Research Centre. 2019-2020. All rights reserved. Website by Ecuson Studio