Cercetătorii OncoGen propun o strategie de vaccinomică personalizată pentru coronavirusul din China

ianuarie 29, 2020 Posted by Cercetătorii OncoGen 0 thoughts on “Cercetătorii OncoGen propun o strategie de vaccinomică personalizată pentru coronavirusul din China”

Virusul de pneumonie care provine din piața de pește din Wuhan, cunoscut ca și Noul Coronavirus 2019 (2019-nCoV) se aseamănă atât cu virușii cauzatori ai sindromului respirator acut sever (SARS) și sindromul respirator din Orientul Mijlociu (MERS). Conform Nature Briefing, până la 28 ianuarie, numărul de cazuri confirmate a depășit 4.500 bolnavi, dintre care mai mult 100 de persoane au decedat ca urmare a infecției. Prin comparație, SARS s-a răspândit la nivel global în 2002-03, infectând 8000 de persoane și ucigând peste 700 de oameni.

Vaccinurile tradiționale pentru bolile virale au avut un succes limitat în cazul epidemiilor virale cu o frecvență ridicată de mutații.  Abordarea pe care am folosit-o pentru identificarea potențialelor peptide candidate pentru vaccin urmează o strategie mai personalizată, denumită vaccinomică, care permite selecția de proteine virale-țintă cu rată de mutație mai scăzută și construcția de peptide adaptate caracteristicilor genetice imune ale populațiilor-țintă ce pot varia în funcție de locația geografică și etnicitate.

Pe baza variației în alela ce codează MHC uman (antigen leucocitar uman), vaccinurile bazate pe peptide pot fi dezvoltate cu specificitate pentru o comunitate sau individ. Selecția peptidelor care pot acționa sub formă de vaccin este determinată de capacitatea de legare a peptidei virale procesate cu moleculele majore de complex de histocompatibilitate (MHC) clasa I și II și poate varia în funcție de alelele HLA relevante. Propunerile noastre de peptide sunt aplicabile populației române.

Detalii tehnice ale strategiei de design pentru peptide:

Am selectat potențiale peptide imunogenice care să declanșeze răspuns imun înnăscut și dobândit (limfocite T CD4+ cât și CD8+) împotriva nCov. În acest scop, am generat peptide sintetice lungi de 15-30 aminoacizi (SLPs), conform celor propuse de Rabu și col. (2019), folosind un linker sensibil la catepsină (LLSVGG) pentru conectarea epitopilor restricționați la MHC clasa I la epitopi specifici pentru MHC clasa II, epitopul MHC clasa II fiind localizat întotdeauna la capătul N-terminal al peptidului. Aceste peptide pot stimula simultan atât limfocitele T CD8+ (citotoxice) cât și limfocitele T CD4+ (helper) (împreună cu sistemul imun înnăscut).

Tulpina de coronavirus Wuhan-Hu-1 folosită pentru analiză este identificată ca MN908947.3 sau Ref Seq NC_045512: https://www.ncbi.nlm.nih.gov/nuccore/NC_045512.2

Este un virus de tip ARN poli-adenilat monocatenar, cu sens pozitiv și un genom cu o dimensiune de  29.9 kb (29903 bp), unul dintre cele mai mari dintre virusurile de tip ARN .

Secvențe genomice complete până în prezent: proteine S și M importante ca țintă pentru vaccinul anti-nCoV; S = spike (pentru aderență și fuziune); M = membrană (pentru replicare și exocitoză a virionului).

Am folosit baza de date Immune Epitope Database (IEDB) pentru a identifica epitopii puternici pentru stimularea limfocitelor T din secvențele proteinelor S și M. Pentru epitopii specifici celulelor T CD8 +, metoda de predicție a integrat capacitatea de legare a MHC clasa I, clivajul proteazomal al proteinei virale și eficiența transportului TAP. Au fost selectați mai mulți epitopi pentru analize suplimentare, în funcție de scorul general obținut și dacă au prezentat o afinitate mare de legare la MHC (IC50 <50 nM) (Tabelul 1). Pentru epitopii specifici limfocitelor T CD4+, s-a ales peptidul cu capacitatea cea mai mare de legare pentru MHC clasa II (Tabelul 2).

Alelele MHC clasa I și clasa II considerate a fi cel mai frecvente răspândite în populația din România, conform datelor publicate de Constantinescu și col. (2017) sunt:

HLA-A*02 (29%)
HLA-A*01 (14.3%)
HLA-A*24 (11.2%)
HLA-B*35 (16%) (superfamily B07)
HLA-B*18 (11%) (superfamily B44)
HLA-DRB1*11 (18.5%)
HLA-DRB1*03 (11.3%)
HLA-DRB1*13 (10.5%)

Peptide sintetice lungi imunogenice țintite pentru proteina virală S

GNYNYLYRLFRKSNLLSVGGYLQPRTFLL

                                                       YLQPRTFLL    HLA-A*0201 epitope

GNYNYLYRLFRKSN                                            HLA-DRB1*1101 epitope

               LYRLFRKSNLLSVG                               HLA-DRB1*1301 epitope

Peptide sintetice lungi imunogenice țintite pentru proteina virală M

SYFIASFRLFARTRSLLSVGGGLMWLSYFI

                                                     GLMWLSYFI  HLA-A*0201 epitope

SYFIASFRLFARTRS                                           HLA-DRB1*1101 epitope

        ASFRLFARTRSLLS                                    HLA-DRB1*1301 epitope

Peptide sintetice lungi imunogenice țintite pentru proteinele virale S și M

SYFIASFRLFARTRSLLSVGGYLQPRTFLL

                                                     YLQPRTFLL  HLA-A*0201 epitope

SYFIASFRLFARTRS                                          HLA-DRB1*1101 epitope

        ASFRLFARTRSLLS                                    HLA-DRB1*1301 epitope

Peptidele imunogenice prezentate mai sus au fost dezvoltate prin aplicarea unei tehnolgoii folosite în vaccinarea personalizată în cancer, bazată pe „long neoantigen peptides”, utilizată în prezent în studii clinice pentru tratarea cancerului.

Acest model este un compromis între strategia de vaccinare industrială globală pe scară largă și cea personalizată la nivel individual.

Vom continua cu validarea acestor peptide și a modelului prezentat.

Sursă imagine: Eye of Science/SPL

Contact

Pius Branzeu Clinical Emergency Hospital
300723 Timisoara, Romania
156, Liviu Rebreanu Boulevard
info@oncogen.ro

© OncoGen Research Centre. 2019. All rights reserved. Website by Ecuson Studio