RESEARCH

OncoGen is a research centre for Gene and Cellular Therapies in Cancer

Applicability of research results in clinical practice

The first research centre in Romania and Eastern Europe, with state-of-the-art equipment for basic and applied research in the field of gene therapies. The Centre has basic and applied research facilities, with 15 compartments including a GMP facility and laboratories endowed with high performance equipment.

PROJECTS

The main research projects developed at OncoGen

Cellular and gene therapies for cancer

Chimeric antigen receptor targeted oncoimmunotherapy with NK cells

Molecular approach to ragweed allergy diagnosis and therapy

Romania-Serbia Joint Initiative against Cancer in Cross-Border Region: Improved Diagnosis and Treatment of Malignant Tumors

BIOeconomic approach to AntiMicrobial agents – use and Resistance

BIOnotechnologies based on Extracellular Vesicles for early diagnosis, prognosis and therapy of atherosclerosis

NEWS & EVENTS

OncoGen’s research activities at a glance

Proiect România-Serbia: diagnostic și tratament personalizat în cancer

Proiect România-Serbia: diagnostic și tratament personalizat în cancer

OncoGen News Press release
Pacienții oncologici au acces la diagnostic și tratament personalizat al bolii, cu ajutorul echipamentelor moderne de la Centrul de Terapii...
Read More
Cercetătorii OncoGen Timișoara, pași decisivi în obținerea unui vaccin personalizat împotriva cancerului

Cercetătorii OncoGen Timișoara, pași decisivi în obținerea unui vaccin personalizat împotriva cancerului

OncoGen News Press release
Colectivul de cercetători de la OncoGen Timișoara angrenat în proiectul CAR-NK a reușit, de curând, punerea la punct a tehnologiei...
Read More
Progress in personalized molecular cancer diagnostics at OncoGen

Progress in personalized molecular cancer diagnostics at OncoGen

OncoGen News Press conference
Romania-Serbia Joint Initiative against Cancer in Cross-Border Region: Improved Diagnosis and Treatment of Malignant Tumors” – ROSECAN On October 25th...
Read More
1 2 3 4
Vaccinul pentru COVID-19 în faza de testare la OncoGen

Vaccinul pentru COVID-19 în faza de testare la OncoGen

O zi importantă pentru OncoGen: avem Vaccinul (echivalentul a 1000 de doze). Astăzi începem testele.
P.S. Ieri am terminat sinteza vaccinului. Azi incepem testele!
❗️Important: Acest vaccin este deocamdată în fază de testare in laborator pe celule umane.

Publicația colectivului OncoGen cu detalii despre design-ul vaccinului: https://www.preprints.org/manuscript/202002.0102/v1

OncoGen researchers  propose personalized vaccinomics strategy for the novel China coronavirus

OncoGen researchers propose personalized vaccinomics strategy for the novel China coronavirus

OncoGen researchers propose a novel approach for producing epitope-based peptide vaccine candidates for the novel China coronavirus (nCoV).

Wuhan seafood market pneumonia virus, also known as 2019 Novel Coronavirus (2019-nCoV) is a relative of both the deadly severe acute respiratory syndrome (SARS) and the Middle East respiratory syndrome (MERS) viruses. According to Nature Briefing, by January 28, the number of confirmed cases has jumped to more than 4,500 with more than 100 people dead as a result of the infection. By comparison, SARS spread globally in 2002-03, infecting 8000 and killing more than 700 people.

Traditional vaccines for viral diseases had limited success in the case of viral epidemics with high mutation rates. The approach that we used for designing potential peptide vaccine candidates takes a more personalized strategy, referred to as vaccinomics, which enables the selection of target viral proteins with low mutation rates, and the design of peptides tuned to the immune characteristics of the target populations, variable based on geographic location and ethnicity.

Based on the human MHC (human leukocyte antigen) allele variation, the peptide vaccines can be made more relevant to a community or individual. The selection of the peptides that could act as vaccines is determined by the binding of the processed viral peptide with the major histocompatibility complex (MHC) class I and II molecules, and the relevant HLA alleles.

Our proposed candidate peptides take into consideration the most frequent HLA alleles found in the Romanian population.

Technical details of the approach used are detailed below:

We identified multiepitope peptide vaccine candidates against nCov that can potentially trigger both CD4+ and CD8+ T cell immune response. To this end, we designed 15-30 aa synthetic long peptides (SLPs), as proposed by Rabu et al. (2019), using a cathepsin-sensitive linker (LLSVGG) for linking MHC class I-restricted epitopes to MHC class II-restricted epitopes, with the MHC class II epitope located always at the N-terminal end, to stimulate both CTLs and T helper lymphocytes (together with innate immune system).

GenBank Acc. No. of coronavirus isolate Wuhan-Hu-1 used for analysis: MN908947.3 which is identical to Ref Seq NC_045512 (provisonal ref seq, under review by NCBI): https://www.ncbi.nlm.nih.gov/nuccore/NC_045512.2

It is an enveloped, positive-sense, single-stranded poly-adenylated RNA virus, with a genome of 29.9 kb (29903 bp), among the largest of all RNA virus genomes.

Complete genomic sequences known to date: S and M proteins important as target for nCoV vaccine; S = spike (for adhesion and fusion); M = membrane (for replication and virion exocytosis).

The tool from the Immune Epitope Database (IEDB) server was used to identify potent T cell epitopes from the sequences of S and M proteins. For CD8+ T cell epitopes, the prediction method integrated MHC class I binding, proteasomal cleavage and TAP transport efficiency. Several epitopes were selected for further analysis based on high overall score and if they showed high MHC binding affinity (IC50 <50 nM) (Table 1). For CD4+ T cell epitopes, the highest ranking peptide based on MHC class II binding was chosen (Table 2).
The class I and class II MHC alleles considered were the most frequent alleles in Romania, according to Constantinescu et al. (2017):

HLA-A*02 (29%)
HLA-A*01 (14.3%)
HLA-A*24 (11.2%)
HLA-B*35 (16%) (superfamily B07)
HLA-B*18 (11%) (superfamily B44)
HLA-DRB1*11 (18.5%)
HLA-DRB1*03 (11.3%)
HLA-DRB1*13 (10.5%)

Synthetic Long Peptide Vaccine candidate for S protein

GNYNYLYRLFRKSNLLSVGGYLQPRTFLL

                                                       YLQPRTFLL    HLA-A*0201 epitope

GNYNYLYRLFRKSN                                            HLA-DRB1*1101 epitope

               LYRLFRKSNLLSVG                               HLA-DRB1*1301 epitope

Synthetic Long Peptide Vaccine candidate for M protein

SYFIASFRLFARTRSLLSVGGGLMWLSYFI

                                                    GLMWLSYFI  HLA-A*0201 epitope

SYFIASFRLFARTRS                                          HLA-DRB1*1101 epitope

        ASFRLFARTRSLLS                                    HLA-DRB1*1301 epitope

Synthetic Long Peptide Vaccine candidate for S and M proteins

SYFIASFRLFARTRSLLSVGGYLQPRTFLL

                                                      YLQPRTFLL  HLA-A*0201 epitope

SYFIASFRLFARTRS                                          HLA-DRB1*1101 epitope

        ASFRLFARTRSLLS                                    HLA-DRB1*1301 epitope

 

The candidate peptides presented above were designed by applying to viral antigens a technology used for personalized vaccination in cancer, based on long neoantigen peptides, currently in clinical trials for cancer therapy.
Based on this model, additional peptide candidates can be identified for populations from different geographic regions of the world.
The current approach is a compromise between an industrial large-scale global vaccination strategy and an individually-targeted personalized vaccination strategy.
We will continue the validation of these candidates and of the model.

Image source: Eye of Science/SPL

Fiziologia azi: Inovare, Integrare, Translatare

Fiziologia azi: Inovare, Integrare, Translatare

În ultimele decenii, fiziologii din toată lumea au devenit tot mai preocupați de fiziologia aplicată, pornind de la nivelul celular până la organe, sisteme și întregul organism uman. În prezent, specialiștii au posibilitatea de a porni într-o adevărată aventură: de a inova metodele de cercetare, de a integra fiziologia cu celelalte științe medicale și de a translata vechile și noile cunoștințe în practica clinică și în cercetare.

Cea de-a 31-a Conferință Națională a Societății Române de Fiziologie – „Fiziologia azi: Inovare, Integrare, Translatare”, care a avut loc în perioada 25-26 octombrie 2019 în Timișoara, la Centrul OncoGen, a acoperit domenii extrem de variate, de la fiziologia cardiovasculară la terapiile inovative, învățământ și cercetare. Conferința a inclus prelegeri invitate, sesiuni plenare, workshop-uri și simpozioane susținute de experți din România și din străinătate, lucrări de înaltă ținută științifică ce au fost prezentate oral sau ca e-postere, toate abordând teme de interes pentru fiziologia zilelor noastre. Pentru prima dată, între coorganizatorii Conferinței de Fiziologie s-a numărat Societatea Națională de Neuroștiințe din România.

Terapiile inovative: tema principală

Ediția din acest an a Conferinței Naționale de Fiziologie a inclus în program sesiuni speciale dedicate diseminării rezultatelor obținute de membrii societății în domenii de cercetare deja consacrate: neuroștiințele (Challenges in experimental and clinical neurosciences; Intercellular interplay in the central nervous system and its roles in neuroplasticity and neuroprotection), fiziologia aparatului cardiovascular (Cardiovascular physiology – new concepts and challenges), fiziologia aparatului respirator (Respiratory Physiology. The paradigm shift in asthma management). De asemenea, au avut loc sesiuni de lucru care deschid noi direcții de cercetare, abordând domenii actuale de top, cu mare relevanță pe plan internațional: terapiile inovative și imunoterapiile (Innovative therapeutic strategies – a step to re-establish physiological function), diagnosticul de precizie în cancer și boli alergice (masa rotundă – Cell physiology: Next generation sequencing in cancer și – Cell Physiology: Molecular diagnosis in allergy), bolile rare (Rare diseases. The current medical approach).
„Ediția din acest an a fost orientată către terapiile inovative. Prezentările au fost axate pe terapiile inovative în cancer, dar și pe bolile alergice, deoarece vrem să dezvoltăm tratamente noi în această direcție. OncoGen a avut două proiecte mari de cercetare, cu bugete de peste două milioane de euro fiecare: unul a fost dedicat studiului alergiei la ambrozie, care face ravagii în România, iar previziunile arată că va îmbolnăvi mai mult de jumătate din Europa în următorii 20-30 de ani. Este o patologie care va fi de interes european. Celălalt studiu a fost legat de terapia inovativă în cancer folosind ingineria genetică. Noi gândim către ceea ce înseamnă medicina secolului XXI – terapia personalizată”, a declarat prof. dr. Carmen Panaitescu, președintele conferinței și director adjunct OncoGen.

Studii clinice multicentrice

Centrul de cercetare de la Timișoara este singurul de acest tip din estul Europei și, prin condițiile și standardele de înaltă siguranță pe care le îndeplineşte, va permite dezvoltarea de noi produse terapeutice pentru uz uman. Centrul este prevăzut cu toate facilitățile și fluxurile tehnologice necesare cercetării de vârf, fiind echipat cu facilități de cercetare fundamentală și aplicată pentru medicina translațională, inclusiv o unitate GMP (două camere de lucru și o încăpere BSL2), o bancă de celule și țesuturi și o biobază. Se urmăreşte promovarea cercetării cu potenţial aplicativ în domeniul terapiilor avansate cu celule stem umane în medicina regenerativă şi pentru obţinerea de produse imunoterapeutice bazate pe tehnologii moderne de biologie moleculară. Includerea Centrului OncoGen în reţeaua internațională de centre cu dotări similare va facilita derularea de studii clinice multicentrice pentru dezvoltarea de tratamente inovatoare în cancer şi în bolile cronice degenerative.

Mecanisme de inginerie genetică

Prof. Torsten Tonn, coordonator al Scientific Advisory Board pentru Institutul OncoGen, a prezentat strategiile la nivel internațional legate tocmai de utilizarea acestor mecanisme de inginerie genetică în tratamentul cancerului și cum pot fi folosite aceleași mecanisme în bolile alergice și în toate bolile autoimune. Potrivit acestuia, imunoterapia își arată din ce în ce mai mult importanța în terapiile cu anticorpi monoclonali și în terapiile biologice, care cuceresc, practic, toate domeniile de patologie. „Centrul OncoGen este specializat în dezvoltarea noilor terapii în cancer, pentru pacienți cu boli extrem de grave. La nivel global are loc o întreagă revoluție medicală, iar România face parte, cu siguranță, din acest trend, și anume folosirea celulelor CAR-T și CAR-NK modificate genetic care pot fi utilizate în tratamentul personalizat al cancerului. Concret, celulele modificate genetic recunosc tumora și o distrug. Este o medicină personalizată, deoarece trebuie să colectezi celulele pacientului, să le manipulezi genetic, să le multiplici și să realizezi tratamentul pentru persoana afectată”, a declarat prof. Tonn.

Terapii biologice în patologia respiratorie

În cadrul sesiunii de alergologie s-a discutat despre diagnosticul molecular în bolile alergice, care ajută medicii să stabilească un diagnostic precis și să poată orienta pacientul către un tratament personalizat. Conf. dr. Roxana Bumbăcea, președintele Societății Române de Alergologie și Imunologie Clinică, a discutat despre managementul modern al astmului și, mai ales, despre terapiile biologice indicate în astmul sever. „Astmul este un subiect care ne preocupă pe toți, deopotrivă alergologi și pneumologi. În astmul sever suntem în momentul terapiei biologice – terapia anti-imunoglobuline E, un anticorp monoclonal umanizat. Pentru noi, ca alergologi, înseamnă foarte mult să avem o terapie anti-Ige care ajută, în principal, în numeroase afecțiuni. Terapia este actualmente poziționată în două afecțiuni importante – astmul și urticaria cronică, însă are o putere mult mai mare și va dovedi că poate face mult mai mult”, a spus alergologul.
În ceea ce privește o altă patologie respiratorie – alergiile, specialiștii au prezentat cele mai noi abordări moleculare pentru imunoterapia alergen-specifică, dar și informații despre alergene recombinante pentru îmbunătățirea diagnosticului și terapiei în alergii – experiența OncoGen cu alergene de ambrozia. „Diagnosticul și tratamentul alergiei la ambrozie pot fi ineficiente din cauza calității slabe a extractelor de alergeni, însă utilizarea unor alergeni recombinați poate rezolva această problemă. Aici, la OncoGen, ne-am propus să dezvoltăm un nou kit de diagnostic bazat pe alergeni recombinați, care va permite, ulterior, și dezvoltarea unui vaccin contra alergiei la ambrozie”, a explicat prof. Kuan-Wei Chen (Universitatea de Medicină Viena, OncoGen).

Sursa: http://www.politicidesanatate.ro/fiziologia-azi-inovare-integrare-translatare/

Contact

Pius Branzeu Clinical Emergency Hospital
300723 Timisoara, Romania
156, Liviu Rebreanu Boulevard
info@oncogen.ro

© OncoGen Research Centre. 2019. All rights reserved. Website by Ecuson Studio